Initial commit

skills/esm/SKILL.md

@@ -0,0 +1,300 @@
+---
+name: esm
+description: Comprehensive toolkit for protein language models including ESM3 (generative multimodal protein design across sequence, structure, and function) and ESM C (efficient protein embeddings and representations). Use this skill when working with protein sequences, structures, or function prediction; designing novel proteins; generating protein embeddings; performing inverse folding; or conducting protein engineering tasks. Supports both local model usage and cloud-based Forge API for scalable inference.
+---
+
+# ESM: Evolutionary Scale Modeling
+
+## Overview
+
+ESM provides state-of-the-art protein language models for understanding, generating, and designing proteins. This skill enables working with two model families: ESM3 for generative protein design across sequence, structure, and function, and ESM C for efficient protein representation learning and embeddings.
+
+## Core Capabilities
+
+### 1. Protein Sequence Generation with ESM3
+
+Generate novel protein sequences with desired properties using multimodal generative modeling.
+
+**When to use:**
+- Designing proteins with specific functional properties
+- Completing partial protein sequences
+- Generating variants of existing proteins
+- Creating proteins with desired structural characteristics
+
+**Basic usage:**
+
+```python
+from esm.models.esm3 import ESM3
+from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
+
+# Load model locally
+model: ESM3InferenceClient = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+
+# Create protein prompt
+protein = ESMProtein(sequence="MPRT___KEND")  # '_' represents masked positions
+
+# Generate completion
+protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))
+print(protein.sequence)
+```
+
+**For remote/cloud usage via Forge API:**
+
+```python
+from esm.sdk.forge import ESM3ForgeInferenceClient
+from esm.sdk.api import ESMProtein, GenerationConfig
+
+# Connect to Forge
+model = ESM3ForgeInferenceClient(model="esm3-medium-2024-08", url="https://forge.evolutionaryscale.ai", token="<token>")
+
+# Generate
+protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))
+```
+
+See `references/esm3-api.md` for detailed ESM3 model specifications, advanced generation configurations, and multimodal prompting examples.
+
+### 2. Structure Prediction and Inverse Folding
+
+Use ESM3's structure track for structure prediction from sequence or inverse folding (sequence design from structure).
+
+**Structure prediction:**
+
+```python
+from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
+
+# Predict structure from sequence
+protein = ESMProtein(sequence="MPRTKEINDAGLIVHSP...")
+protein_with_structure = model.generate(
+    protein,
+    GenerationConfig(track="structure", num_steps=protein.sequence.count("_"))
+)
+
+# Access predicted structure
+coordinates = protein_with_structure.coordinates  # 3D coordinates
+pdb_string = protein_with_structure.to_pdb()
+```
+
+**Inverse folding (sequence from structure):**
+
+```python
+# Design sequence for a target structure
+protein_with_structure = ESMProtein.from_pdb("target_structure.pdb")
+protein_with_structure.sequence = None  # Remove sequence
+
+# Generate sequence that folds to this structure
+designed_protein = model.generate(
+    protein_with_structure,
+    GenerationConfig(track="sequence", num_steps=50, temperature=0.7)
+)
+```
+
+### 3. Protein Embeddings with ESM C
+
+Generate high-quality embeddings for downstream tasks like function prediction, classification, or similarity analysis.
+
+**When to use:**
+- Extracting protein representations for machine learning
+- Computing sequence similarities
+- Feature extraction for protein classification
+- Transfer learning for protein-related tasks
+
+**Basic usage:**
+
+```python
+from esm.models.esmc import ESMC
+from esm.sdk.api import ESMProtein
+
+# Load ESM C model
+model = ESMC.from_pretrained("esmc-300m").to("cuda")
+
+# Get embeddings
+protein = ESMProtein(sequence="MPRTKEINDAGLIVHSP...")
+protein_tensor = model.encode(protein)
+
+# Generate embeddings
+embeddings = model.forward(protein_tensor)
+```
+
+**Batch processing:**
+
+```python
+# Encode multiple proteins
+proteins = [
+    ESMProtein(sequence="MPRTKEIND..."),
+    ESMProtein(sequence="AGLIVHSPQ..."),
+    ESMProtein(sequence="KTEFLNDGR...")
+]
+
+embeddings_list = [model.logits(model.forward(model.encode(p))) for p in proteins]
+```
+
+See `references/esm-c-api.md` for ESM C model details, efficiency comparisons, and advanced embedding strategies.
+
+### 4. Function Conditioning and Annotation
+
+Use ESM3's function track to generate proteins with specific functional annotations or predict function from sequence.
+
+**Function-conditioned generation:**
+
+```python
+from esm.sdk.api import ESMProtein, FunctionAnnotation, GenerationConfig
+
+# Create protein with desired function
+protein = ESMProtein(
+    sequence="_" * 200,  # Generate 200 residue protein
+    function_annotations=[
+        FunctionAnnotation(label="fluorescent_protein", start=50, end=150)
+    ]
+)
+
+# Generate sequence with specified function
+functional_protein = model.generate(
+    protein,
+    GenerationConfig(track="sequence", num_steps=200)
+)
+```
+
+### 5. Chain-of-Thought Generation
+
+Iteratively refine protein designs using ESM3's chain-of-thought generation approach.
+
+```python
+from esm.sdk.api import GenerationConfig
+
+# Multi-step refinement
+protein = ESMProtein(sequence="MPRT" + "_" * 100 + "KEND")
+
+# Step 1: Generate initial structure
+config = GenerationConfig(track="structure", num_steps=50)
+protein = model.generate(protein, config)
+
+# Step 2: Refine sequence based on structure
+config = GenerationConfig(track="sequence", num_steps=50, temperature=0.5)
+protein = model.generate(protein, config)
+
+# Step 3: Predict function
+config = GenerationConfig(track="function", num_steps=20)
+protein = model.generate(protein, config)
+```
+
+### 6. Batch Processing with Forge API
+
+Process multiple proteins efficiently using Forge's async executor.
+
+```python
+from esm.sdk.forge import ESM3ForgeInferenceClient
+import asyncio
+
+client = ESM3ForgeInferenceClient(model="esm3-medium-2024-08", token="<token>")
+
+# Async batch processing
+async def batch_generate(proteins_list):
+    tasks = [
+        client.async_generate(protein, GenerationConfig(track="sequence"))
+        for protein in proteins_list
+    ]
+    return await asyncio.gather(*tasks)
+
+# Execute
+proteins = [ESMProtein(sequence=f"MPRT{'_' * 50}KEND") for _ in range(10)]
+results = asyncio.run(batch_generate(proteins))
+```
+
+See `references/forge-api.md` for detailed Forge API documentation, authentication, rate limits, and batch processing patterns.
+
+## Model Selection Guide
+
+**ESM3 Models (Generative):**
+- `esm3-sm-open-v1` (1.4B) - Open weights, local usage, good for experimentation
+- `esm3-medium-2024-08` (7B) - Best balance of quality and speed (Forge only)
+- `esm3-large-2024-03` (98B) - Highest quality, slower (Forge only)
+
+**ESM C Models (Embeddings):**
+- `esmc-300m` (30 layers) - Lightweight, fast inference
+- `esmc-600m` (36 layers) - Balanced performance
+- `esmc-6b` (80 layers) - Maximum representation quality
+
+**Selection criteria:**
+- **Local development/testing:** Use `esm3-sm-open-v1` or `esmc-300m`
+- **Production quality:** Use `esm3-medium-2024-08` via Forge
+- **Maximum accuracy:** Use `esm3-large-2024-03` or `esmc-6b`
+- **High throughput:** Use Forge API with batch executor
+- **Cost optimization:** Use smaller models, implement caching strategies
+
+## Installation
+
+**Basic installation:**
+
+```bash
+uv pip install esm
+```
+
+**With Flash Attention (recommended for faster inference):**
+
+```bash
+uv pip install esm
+uv pip install flash-attn --no-build-isolation
+```
+
+**For Forge API access:**
+
+```bash
+uv pip install esm  # SDK includes Forge client
+```
+
+No additional dependencies needed. Obtain Forge API token at https://forge.evolutionaryscale.ai
+
+## Common Workflows
+
+For detailed examples and complete workflows, see `references/workflows.md` which includes:
+- Novel GFP design with chain-of-thought
+- Protein variant generation and screening
+- Structure-based sequence optimization
+- Function prediction pipelines
+- Embedding-based clustering and analysis
+
+## References
+
+This skill includes comprehensive reference documentation:
+
+- `references/esm3-api.md` - ESM3 model architecture, API reference, generation parameters, and multimodal prompting
+- `references/esm-c-api.md` - ESM C model details, embedding strategies, and performance optimization
+- `references/forge-api.md` - Forge platform documentation, authentication, batch processing, and deployment
+- `references/workflows.md` - Complete examples and common workflow patterns
+
+These references contain detailed API specifications, parameter descriptions, and advanced usage patterns. Load them as needed for specific tasks.
+
+## Best Practices
+
+**For generation tasks:**
+- Start with smaller models for prototyping (`esm3-sm-open-v1`)
+- Use temperature parameter to control diversity (0.0 = deterministic, 1.0 = diverse)
+- Implement iterative refinement with chain-of-thought for complex designs
+- Validate generated sequences with structure prediction or wet-lab experiments
+
+**For embedding tasks:**
+- Batch process sequences when possible for efficiency
+- Cache embeddings for repeated analyses
+- Normalize embeddings when computing similarities
+- Use appropriate model size based on downstream task requirements
+
+**For production deployment:**
+- Use Forge API for scalability and latest models
+- Implement error handling and retry logic for API calls
+- Monitor token usage and implement rate limiting
+- Consider AWS SageMaker deployment for dedicated infrastructure
+
+## Resources and Documentation
+
+- **GitHub Repository:** https://github.com/evolutionaryscale/esm
+- **Forge Platform:** https://forge.evolutionaryscale.ai
+- **Scientific Paper:** Hayes et al., Science (2025) - https://www.science.org/doi/10.1126/science.ads0018
+- **Blog Posts:**
+  - ESM3 Release: https://www.evolutionaryscale.ai/blog/esm3-release
+  - ESM C Launch: https://www.evolutionaryscale.ai/blog/esm-cambrian
+- **Community:** Slack community at https://bit.ly/3FKwcWd
+- **Model Weights:** HuggingFace EvolutionaryScale organization
+
+## Responsible Use
+
+ESM is designed for beneficial applications in protein engineering, drug discovery, and scientific research. Follow the Responsible Biodesign Framework (https://responsiblebiodesign.ai/) when designing novel proteins. Consider biosafety and ethical implications of protein designs before experimental validation.

skills/esm/references/esm-c-api.md

@@ -0,0 +1,583 @@
+# ESM C API Reference
+
+## Overview
+
+ESM C (Cambrian) is a family of protein language models optimized for representation learning and efficient embedding generation. Designed as a drop-in replacement for ESM2, ESM C provides significant improvements in speed and quality across all model sizes.
+
+## Model Architecture
+
+**ESM C Family Models:**
+
+| Model ID | Parameters | Layers | Best For |
+|----------|-----------|--------|----------|
+| `esmc-300m` | 300M | 30 | Fast inference, lightweight applications |
+| `esmc-600m` | 600M | 36 | Balanced performance and quality |
+| `esmc-6b` | 6B | 80 | Maximum representation quality |
+
+**Key Features:**
+- 3x faster inference than ESM2
+- Improved perplexity and embedding quality
+- Efficient architecture for production deployment
+- Compatible with ESM2 workflows (drop-in replacement)
+- Support for long sequences (up to 1024 residues efficiently)
+
+**Architecture Improvements over ESM2:**
+- Optimized attention mechanisms
+- Better token representation
+- Enhanced training procedures
+- Reduced memory footprint
+
+## Core API Components
+
+### ESMC Class
+
+Main interface for ESM C models.
+
+**Model Loading:**
+
+```python
+from esm.models.esmc import ESMC
+from esm.sdk.api import ESMProtein
+
+# Load model with automatic device placement
+model = ESMC.from_pretrained("esmc-300m").to("cuda")
+
+# Or specify device explicitly
+model = ESMC.from_pretrained("esmc-600m").to("cpu")
+
+# For maximum quality
+model = ESMC.from_pretrained("esmc-6b").to("cuda")
+```
+
+**Model Selection Criteria:**
+
+- **esmc-300m**: Development, real-time applications, batch processing of many sequences
+- **esmc-600m**: Production deployments, good quality/speed balance
+- **esmc-6b**: Research, maximum accuracy for downstream tasks
+
+### Basic Embedding Generation
+
+**Single Sequence:**
+
+```python
+from esm.models.esmc import ESMC
+from esm.sdk.api import ESMProtein
+
+# Load model
+model = ESMC.from_pretrained("esmc-600m").to("cuda")
+
+# Create protein
+protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
+
+# Encode to tensor
+protein_tensor = model.encode(protein)
+
+# Generate embeddings
+embeddings = model.forward(protein_tensor)
+
+# Get logits (per-position predictions)
+logits = model.logits(embeddings)
+
+print(f"Embedding shape: {embeddings.shape}")
+print(f"Logits shape: {logits.shape}")
+```
+
+**Output Shapes:**
+
+For a sequence of length L:
+- `embeddings.shape`: `(1, L, hidden_dim)` where hidden_dim depends on model
+  - esmc-300m: hidden_dim = 960
+  - esmc-600m: hidden_dim = 1152
+  - esmc-6b: hidden_dim = 2560
+- `logits.shape`: `(1, L, 64)` - per-position amino acid predictions
+
+### Batch Processing
+
+Process multiple sequences efficiently:
+
+```python
+import torch
+
+# Multiple proteins
+sequences = [
+    "MPRTKEINDAGLIVHSP",
+    "AGKWFYLTQSNHERVPM",
+    "DEIFKRNAVWGSLTPQY"
+]
+
+proteins = [ESMProtein(sequence=seq) for seq in sequences]
+
+# Encode all
+protein_tensors = [model.encode(p) for p in proteins]
+
+# Process batch (if same length)
+# For variable lengths, process individually or pad
+embeddings_list = []
+for tensor in protein_tensors:
+    embedding = model.forward(tensor)
+    embeddings_list.append(embedding)
+
+print(f"Processed {len(embeddings_list)} proteins")
+```
+
+**Efficient Batching for Variable Lengths:**
+
+```python
+def batch_encode_variable_length(model, sequences, max_batch_size=32):
+    """
+    Efficiently batch encode sequences of variable length.
+    Groups by similar length for efficiency.
+    """
+    # Sort by length
+    sorted_seqs = sorted(enumerate(sequences), key=lambda x: len(x[1]))
+
+    results = [None] * len(sequences)
+    batch = []
+    batch_indices = []
+
+    for idx, seq in sorted_seqs:
+        batch.append(seq)
+        batch_indices.append(idx)
+
+        # Process batch when full or length changes significantly
+        if (len(batch) >= max_batch_size or
+            (len(batch) > 0 and abs(len(seq) - len(batch[0])) > 10)):
+
+            # Process current batch
+            proteins = [ESMProtein(sequence=s) for s in batch]
+            embeddings = [model.forward(model.encode(p)) for p in proteins]
+
+            # Store results
+            for i, emb in zip(batch_indices, embeddings):
+                results[i] = emb
+
+            batch = []
+            batch_indices = []
+
+    # Process remaining
+    if batch:
+        proteins = [ESMProtein(sequence=s) for s in batch]
+        embeddings = [model.forward(model.encode(p)) for p in proteins]
+        for i, emb in zip(batch_indices, embeddings):
+            results[i] = emb
+
+    return results
+```
+
+## Common Use Cases
+
+### 1. Sequence Similarity Analysis
+
+Compute similarity between proteins using embeddings:
+
+```python
+import torch
+import torch.nn.functional as F
+
+def get_sequence_embedding(model, sequence):
+    """Get mean-pooled sequence embedding."""
+    protein = ESMProtein(sequence=sequence)
+    tensor = model.encode(protein)
+    embedding = model.forward(tensor)
+
+    # Mean pooling over sequence length
+    return embedding.mean(dim=1)
+
+# Get embeddings
+seq1_emb = get_sequence_embedding(model, "MPRTKEINDAGLIVHSP")
+seq2_emb = get_sequence_embedding(model, "MPRTKEINDAGLIVHSQ")  # Similar
+seq3_emb = get_sequence_embedding(model, "WWWWWWWWWWWWWWWWW")  # Different
+
+# Compute cosine similarity
+sim_1_2 = F.cosine_similarity(seq1_emb, seq2_emb)
+sim_1_3 = F.cosine_similarity(seq1_emb, seq3_emb)
+
+print(f"Similarity (1,2): {sim_1_2.item():.4f}")
+print(f"Similarity (1,3): {sim_1_3.item():.4f}")
+```
+
+### 2. Protein Classification
+
+Use embeddings as features for classification:
+
+```python
+import numpy as np
+from sklearn.linear_model import LogisticRegression
+from sklearn.model_selection import train_test_split
+
+# Generate embeddings for training set
+def embed_dataset(model, sequences):
+    embeddings = []
+    for seq in sequences:
+        protein = ESMProtein(sequence=seq)
+        tensor = model.encode(protein)
+        emb = model.forward(tensor).mean(dim=1)  # Mean pooling
+        embeddings.append(emb.cpu().detach().numpy().flatten())
+    return np.array(embeddings)
+
+# Example: Classify proteins by function
+train_sequences = [...]  # Your sequences
+train_labels = [...]      # Your labels
+
+embeddings = embed_dataset(model, train_sequences)
+
+# Train classifier
+X_train, X_test, y_train, y_test = train_test_split(
+    embeddings, train_labels, test_size=0.2
+)
+
+classifier = LogisticRegression(max_iter=1000)
+classifier.fit(X_train, y_train)
+
+# Evaluate
+accuracy = classifier.score(X_test, y_test)
+print(f"Classification accuracy: {accuracy:.4f}")
+```
+
+### 3. Protein Clustering
+
+Cluster proteins based on sequence similarity:
+
+```python
+from sklearn.cluster import KMeans
+import numpy as np
+
+# Generate embeddings
+sequences = [...]  # Your protein sequences
+embeddings = embed_dataset(model, sequences)
+
+# Cluster
+n_clusters = 5
+kmeans = KMeans(n_clusters=n_clusters, random_state=42)
+cluster_labels = kmeans.fit_predict(embeddings)
+
+# Analyze clusters
+for i in range(n_clusters):
+    cluster_seqs = [seq for seq, label in zip(sequences, cluster_labels) if label == i]
+    print(f"Cluster {i}: {len(cluster_seqs)} sequences")
+```
+
+### 4. Sequence Search and Retrieval
+
+Find similar sequences in a database:
+
+```python
+import torch
+import numpy as np
+from sklearn.metrics.pairwise import cosine_similarity
+
+def build_sequence_index(model, database_sequences):
+    """Build searchable index of sequence embeddings."""
+    embeddings = []
+    for seq in database_sequences:
+        emb = get_sequence_embedding(model, seq)
+        embeddings.append(emb.cpu().detach().numpy().flatten())
+    return np.array(embeddings)
+
+def search_similar_sequences(model, query_seq, database_embeddings,
+                            database_sequences, top_k=10):
+    """Find top-k most similar sequences."""
+    query_emb = get_sequence_embedding(model, query_seq)
+    query_emb_np = query_emb.cpu().detach().numpy().flatten().reshape(1, -1)
+
+    # Compute similarities
+    similarities = cosine_similarity(query_emb_np, database_embeddings)[0]
+
+    # Get top-k
+    top_indices = np.argsort(similarities)[-top_k:][::-1]
+
+    results = [
+        (database_sequences[idx], similarities[idx])
+        for idx in top_indices
+    ]
+    return results
+
+# Example usage
+database_seqs = [...]  # Large sequence database
+index = build_sequence_index(model, database_seqs)
+
+query = "MPRTKEINDAGLIVHSP"
+similar = search_similar_sequences(model, query, index, database_seqs, top_k=5)
+
+for seq, score in similar:
+    print(f"Score: {score:.4f} - {seq[:30]}...")
+```
+
+### 5. Feature Extraction for Downstream Models
+
+Use ESM C embeddings as input to custom neural networks:
+
+```python
+import torch.nn as nn
+
+class ProteinPropertyPredictor(nn.Module):
+    """Example: Predict protein properties from ESM C embeddings."""
+
+    def __init__(self, embedding_dim, hidden_dim, output_dim):
+        super().__init__()
+        self.fc1 = nn.Linear(embedding_dim, hidden_dim)
+        self.fc2 = nn.Linear(hidden_dim, hidden_dim)
+        self.fc3 = nn.Linear(hidden_dim, output_dim)
+        self.relu = nn.ReLU()
+        self.dropout = nn.Dropout(0.3)
+
+    def forward(self, embeddings):
+        # embeddings: (batch, seq_len, embedding_dim)
+        # Mean pool over sequence
+        x = embeddings.mean(dim=1)
+
+        x = self.relu(self.fc1(x))
+        x = self.dropout(x)
+        x = self.relu(self.fc2(x))
+        x = self.dropout(x)
+        x = self.fc3(x)
+        return x
+
+# Use ESM C as frozen feature extractor
+esm_model = ESMC.from_pretrained("esmc-600m").to("cuda")
+esm_model.eval()  # Freeze
+
+# Create task-specific model
+predictor = ProteinPropertyPredictor(
+    embedding_dim=1152,  # esmc-600m dimension
+    hidden_dim=512,
+    output_dim=1  # e.g., stability score
+).to("cuda")
+
+# Training loop
+for sequence, target in dataloader:
+    protein = ESMProtein(sequence=sequence)
+    with torch.no_grad():
+        embeddings = esm_model.forward(esm_model.encode(protein))
+
+    prediction = predictor(embeddings)
+    loss = criterion(prediction, target)
+    # ... backprop through predictor only
+```
+
+### 6. Per-Residue Analysis
+
+Extract per-residue representations for detailed analysis:
+
+```python
+def get_per_residue_embeddings(model, sequence):
+    """Get embedding for each residue."""
+    protein = ESMProtein(sequence=sequence)
+    tensor = model.encode(protein)
+    embeddings = model.forward(tensor)
+
+    # embeddings shape: (1, seq_len, hidden_dim)
+    return embeddings.squeeze(0)  # (seq_len, hidden_dim)
+
+# Analyze specific positions
+sequence = "MPRTKEINDAGLIVHSPQWFYK"
+residue_embeddings = get_per_residue_embeddings(model, sequence)
+
+# Extract features for position 10
+position_10_features = residue_embeddings[10]
+print(f"Features for residue {sequence[10]} at position 10:")
+print(f"Shape: {position_10_features.shape}")
+
+# Compare residue representations
+pos_5 = residue_embeddings[5]
+pos_15 = residue_embeddings[15]
+similarity = F.cosine_similarity(pos_5, pos_15, dim=0)
+print(f"Residue similarity: {similarity.item():.4f}")
+```
+
+## Performance Optimization
+
+### Memory Management
+
+```python
+import torch
+
+# Use half precision for memory efficiency
+model = ESMC.from_pretrained("esmc-600m").to("cuda").half()
+
+# Process with mixed precision
+with torch.cuda.amp.autocast():
+    embeddings = model.forward(model.encode(protein))
+
+# Clear cache between batches
+torch.cuda.empty_cache()
+```
+
+### Batch Processing Best Practices
+
+```python
+def efficient_batch_processing(model, sequences, batch_size=32):
+    """Process sequences in optimized batches."""
+    results = []
+
+    for i in range(0, len(sequences), batch_size):
+        batch = sequences[i:i + batch_size]
+
+        # Process batch
+        batch_embeddings = []
+        for seq in batch:
+            protein = ESMProtein(sequence=seq)
+            emb = model.forward(model.encode(protein))
+            batch_embeddings.append(emb)
+
+        results.extend(batch_embeddings)
+
+        # Periodically clear cache
+        if i % (batch_size * 10) == 0:
+            torch.cuda.empty_cache()
+
+    return results
+```
+
+### Caching Embeddings
+
+```python
+import pickle
+import hashlib
+
+def get_cache_key(sequence):
+    """Generate cache key for sequence."""
+    return hashlib.md5(sequence.encode()).hexdigest()
+
+class EmbeddingCache:
+    """Cache for protein embeddings."""
+
+    def __init__(self, cache_file="embeddings_cache.pkl"):
+        self.cache_file = cache_file
+        try:
+            with open(cache_file, 'rb') as f:
+                self.cache = pickle.load(f)
+        except FileNotFoundError:
+            self.cache = {}
+
+    def get(self, sequence):
+        key = get_cache_key(sequence)
+        return self.cache.get(key)
+
+    def set(self, sequence, embedding):
+        key = get_cache_key(sequence)
+        self.cache[key] = embedding
+
+    def save(self):
+        with open(self.cache_file, 'wb') as f:
+            pickle.dump(self.cache, f)
+
+# Usage
+cache = EmbeddingCache()
+
+def get_embedding_cached(model, sequence):
+    cached = cache.get(sequence)
+    if cached is not None:
+        return cached
+
+    # Compute
+    protein = ESMProtein(sequence=sequence)
+    embedding = model.forward(model.encode(protein))
+    cache.set(sequence, embedding)
+
+    return embedding
+
+# Don't forget to save cache
+cache.save()
+```
+
+## Comparison with ESM2
+
+**Performance Improvements:**
+
+| Metric | ESM2-650M | ESM C-600M | Improvement |
+|--------|-----------|------------|-------------|
+| Inference Speed | 1.0x | 3.0x | 3x faster |
+| Perplexity | Higher | Lower | Better |
+| Memory Usage | 1.0x | 0.8x | 20% less |
+| Embedding Quality | Baseline | Improved | +5-10% |
+
+**Migration from ESM2:**
+
+ESM C is designed as a drop-in replacement:
+
+```python
+# Old ESM2 code
+from esm import pretrained
+model, alphabet = pretrained.esm2_t33_650M_UR50D()
+
+# New ESM C code (similar API)
+from esm.models.esmc import ESMC
+model = ESMC.from_pretrained("esmc-600m")
+```
+
+Key differences:
+- Faster inference with same or better quality
+- Simplified API through ESMProtein
+- Better support for long sequences
+- More efficient memory usage
+
+## Advanced Topics
+
+### Fine-tuning ESM C
+
+ESM C can be fine-tuned for specific tasks:
+
+```python
+import torch.optim as optim
+
+# Load model
+model = ESMC.from_pretrained("esmc-300m").to("cuda")
+
+# Unfreeze for fine-tuning
+for param in model.parameters():
+    param.requires_grad = True
+
+# Define optimizer
+optimizer = optim.Adam(model.parameters(), lr=1e-5)
+
+# Training loop
+for epoch in range(num_epochs):
+    for sequences, labels in dataloader:
+        optimizer.zero_grad()
+
+        # Forward pass
+        proteins = [ESMProtein(sequence=seq) for seq in sequences]
+        embeddings = [model.forward(model.encode(p)) for p in proteins]
+
+        # Your task-specific loss
+        loss = compute_loss(embeddings, labels)
+
+        loss.backward()
+        optimizer.step()
+```
+
+### Attention Visualization
+
+Extract attention weights for interpretability:
+
+```python
+def get_attention_weights(model, sequence):
+    """Extract attention weights from model."""
+    protein = ESMProtein(sequence=sequence)
+    tensor = model.encode(protein)
+
+    # Forward with attention output
+    output = model.forward(tensor, output_attentions=True)
+
+    return output.attentions  # List of attention tensors per layer
+
+# Visualize attention
+attentions = get_attention_weights(model, "MPRTKEINDAGLIVHSP")
+# Process and visualize attention patterns
+```
+
+## Citation
+
+If using ESM C in research, cite:
+
+```
+ESM Cambrian: https://www.evolutionaryscale.ai/blog/esm-cambrian
+EvolutionaryScale (2024)
+```
+
+## Additional Resources
+
+- ESM C blog post: https://www.evolutionaryscale.ai/blog/esm-cambrian
+- Model weights: HuggingFace EvolutionaryScale organization
+- Comparison benchmarks: See blog post for detailed performance comparisons

skills/esm/references/esm3-api.md

@@ -0,0 +1,452 @@
+# ESM3 API Reference
+
+## Overview
+
+ESM3 is a frontier multimodal generative language model that reasons over the sequence, structure, and function of proteins. It uses iterative masked language modeling to simultaneously generate across these three modalities.
+
+## Model Architecture
+
+**ESM3 Family Models:**
+
+| Model ID | Parameters | Availability | Best For |
+|----------|-----------|--------------|----------|
+| `esm3-sm-open-v1` | 1.4B | Open weights (local) | Development, testing, learning |
+| `esm3-medium-2024-08` | 7B | Forge API only | Production, balanced quality/speed |
+| `esm3-large-2024-03` | 98B | Forge API only | Maximum quality, research |
+| `esm3-medium-multimer-2024-09` | 7B | Forge API only | Protein complexes (experimental) |
+
+**Key Features:**
+- Simultaneous reasoning across sequence, structure, and function
+- Iterative generation with controllable number of steps
+- Support for partial prompting across modalities
+- Chain-of-thought generation for complex designs
+- Temperature control for generation diversity
+
+## Core API Components
+
+### ESMProtein Class
+
+The central data structure representing a protein with optional sequence, structure, and function information.
+
+**Constructor:**
+
+```python
+from esm.sdk.api import ESMProtein
+
+protein = ESMProtein(
+    sequence="MPRTKEINDAGLIVHSP",           # Amino acid sequence (optional)
+    coordinates=coordinates_array,          # 3D structure (optional)
+    function_annotations=[...],             # Function labels (optional)
+    secondary_structure="HHHEEEECCC",       # SS annotations (optional)
+    sasa=sasa_array                        # Solvent accessibility (optional)
+)
+```
+
+**Key Methods:**
+
+```python
+# Load from PDB file
+protein = ESMProtein.from_pdb("protein.pdb")
+
+# Export to PDB format
+pdb_string = protein.to_pdb()
+
+# Save to file
+with open("output.pdb", "w") as f:
+    f.write(protein.to_pdb())
+```
+
+**Masking Conventions:**
+
+Use `_` (underscore) to represent masked positions for generation:
+
+```python
+# Mask positions 5-10 for generation
+protein = ESMProtein(sequence="MPRT______AGLIVHSP")
+
+# Fully masked sequence (generate from scratch)
+protein = ESMProtein(sequence="_" * 200)
+
+# Partial structure (some coordinates None)
+protein = ESMProtein(
+    sequence="MPRTKEIND",
+    coordinates=partial_coords  # Some positions can be None
+)
+```
+
+### GenerationConfig Class
+
+Controls generation behavior and parameters.
+
+**Basic Configuration:**
+
+```python
+from esm.sdk.api import GenerationConfig
+
+config = GenerationConfig(
+    track="sequence",              # Track to generate: "sequence", "structure", or "function"
+    num_steps=8,                  # Number of demasking steps
+    temperature=0.7,              # Sampling temperature (0.0-1.0)
+    top_p=None,                   # Nucleus sampling threshold
+    condition_on_coordinates_only=False  # For structure conditioning
+)
+```
+
+**Parameter Details:**
+
+- **track**: Which modality to generate
+  - `"sequence"`: Generate amino acid sequence
+  - `"structure"`: Generate 3D coordinates
+  - `"function"`: Generate function annotations
+
+- **num_steps**: Number of iterative demasking steps
+  - Higher = slower but potentially better quality
+  - Typical range: 8-100 depending on sequence length
+  - For full sequence generation: approximately sequence_length / 2
+
+- **temperature**: Controls randomness
+  - 0.0: Fully deterministic (greedy decoding)
+  - 0.5-0.7: Balanced exploration
+  - 1.0: Maximum diversity
+  - Higher values increase novelty but may reduce quality
+
+- **top_p**: Nucleus sampling parameter
+  - Limits sampling to top probability mass
+  - Values: 0.0-1.0 (e.g., 0.9 = sample from top 90% probability mass)
+  - Use for controlled diversity without extreme sampling
+
+- **condition_on_coordinates_only**: Structure conditioning mode
+  - `True`: Condition only on backbone coordinates (ignore sequence)
+  - Useful for inverse folding tasks
+
+### ESM3InferenceClient Interface
+
+The unified interface for both local and remote inference.
+
+**Local Model Loading:**
+
+```python
+from esm.models.esm3 import ESM3
+
+# Load with automatic device placement
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+
+# Or explicitly specify device
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cpu")
+```
+
+**Generation Method:**
+
+```python
+# Basic generation
+protein_output = model.generate(protein_input, config)
+
+# With explicit track specification
+protein_output = model.generate(
+    protein_input,
+    GenerationConfig(track="sequence", num_steps=16, temperature=0.6)
+)
+```
+
+**Forward Pass (Advanced):**
+
+```python
+# Get raw model logits for custom sampling
+protein_tensor = model.encode(protein)
+output = model.forward(protein_tensor)
+logits = model.decode(output)
+```
+
+## Common Usage Patterns
+
+### 1. Sequence Completion
+
+Fill in masked regions of a protein sequence:
+
+```python
+# Define partial sequence
+protein = ESMProtein(sequence="MPRTK____LIVHSP____END")
+
+# Generate missing positions
+config = GenerationConfig(track="sequence", num_steps=12, temperature=0.5)
+completed = model.generate(protein, config)
+
+print(f"Original:  {protein.sequence}")
+print(f"Completed: {completed.sequence}")
+```
+
+### 2. Structure Prediction
+
+Predict 3D structure from sequence:
+
+```python
+# Input: sequence only
+protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
+
+# Generate structure
+config = GenerationConfig(track="structure", num_steps=len(protein.sequence))
+protein_with_structure = model.generate(protein, config)
+
+# Save as PDB
+with open("predicted_structure.pdb", "w") as f:
+    f.write(protein_with_structure.to_pdb())
+```
+
+### 3. Inverse Folding
+
+Design sequence for a target structure:
+
+```python
+# Load target structure
+target = ESMProtein.from_pdb("target.pdb")
+
+# Remove sequence, keep structure
+target.sequence = None
+
+# Generate sequence that folds to this structure
+config = GenerationConfig(
+    track="sequence",
+    num_steps=50,
+    temperature=0.7,
+    condition_on_coordinates_only=True
+)
+designed = model.generate(target, config)
+
+print(f"Designed sequence: {designed.sequence}")
+```
+
+### 4. Function-Conditioned Generation
+
+Generate protein with specific function:
+
+```python
+from esm.sdk.api import FunctionAnnotation
+
+# Specify desired function
+protein = ESMProtein(
+    sequence="_" * 150,
+    function_annotations=[
+        FunctionAnnotation(
+            label="enzymatic_activity",
+            start=30,
+            end=90
+        )
+    ]
+)
+
+# Generate sequence with this function
+config = GenerationConfig(track="sequence", num_steps=75, temperature=0.6)
+functional_protein = model.generate(protein, config)
+```
+
+### 5. Multi-Track Generation (Chain-of-Thought)
+
+Iteratively generate across multiple tracks:
+
+```python
+# Start with partial sequence
+protein = ESMProtein(sequence="MPRT" + "_" * 100)
+
+# Step 1: Complete sequence
+protein = model.generate(
+    protein,
+    GenerationConfig(track="sequence", num_steps=50, temperature=0.6)
+)
+
+# Step 2: Predict structure for completed sequence
+protein = model.generate(
+    protein,
+    GenerationConfig(track="structure", num_steps=50)
+)
+
+# Step 3: Predict function
+protein = model.generate(
+    protein,
+    GenerationConfig(track="function", num_steps=20)
+)
+
+print(f"Final sequence: {protein.sequence}")
+print(f"Functions: {protein.function_annotations}")
+```
+
+### 6. Variant Generation
+
+Generate multiple variants of a protein:
+
+```python
+import numpy as np
+
+base_sequence = "MPRTKEINDAGLIVHSPQWFYK"
+variants = []
+
+for i in range(10):
+    # Mask random positions
+    seq_list = list(base_sequence)
+    mask_indices = np.random.choice(len(seq_list), size=5, replace=False)
+    for idx in mask_indices:
+        seq_list[idx] = '_'
+
+    protein = ESMProtein(sequence=''.join(seq_list))
+
+    # Generate variant
+    variant = model.generate(
+        protein,
+        GenerationConfig(track="sequence", num_steps=8, temperature=0.8)
+    )
+    variants.append(variant.sequence)
+
+print(f"Generated {len(variants)} variants")
+```
+
+## Advanced Topics
+
+### Temperature Scheduling
+
+Vary temperature during generation for better control:
+
+```python
+def generate_with_temperature_schedule(model, protein, temperatures):
+    """Generate with decreasing temperature for annealing."""
+    current = protein
+    steps_per_temp = 10
+
+    for temp in temperatures:
+        config = GenerationConfig(
+            track="sequence",
+            num_steps=steps_per_temp,
+            temperature=temp
+        )
+        current = model.generate(current, config)
+
+    return current
+
+# Example: Start diverse, end deterministic
+result = generate_with_temperature_schedule(
+    model,
+    protein,
+    temperatures=[1.0, 0.8, 0.6, 0.4, 0.2]
+)
+```
+
+### Constrained Generation
+
+Preserve specific regions during generation:
+
+```python
+# Keep active site residues fixed
+def mask_except_active_site(sequence, active_site_positions):
+    """Mask everything except specified positions."""
+    seq_list = ['_'] * len(sequence)
+    for pos in active_site_positions:
+        seq_list[pos] = sequence[pos]
+    return ''.join(seq_list)
+
+# Define active site
+active_site = [23, 24, 25, 45, 46, 89]
+constrained_seq = mask_except_active_site(original_sequence, active_site)
+
+protein = ESMProtein(sequence=constrained_seq)
+result = model.generate(protein, GenerationConfig(track="sequence", num_steps=50))
+```
+
+### Secondary Structure Conditioning
+
+Use secondary structure information in generation:
+
+```python
+# Define secondary structure (H=helix, E=sheet, C=coil)
+protein = ESMProtein(
+    sequence="_" * 80,
+    secondary_structure="CCHHHHHHHEEEEECCCHHHHHHCC" + "C" * 55
+)
+
+# Generate sequence with this structure
+result = model.generate(
+    protein,
+    GenerationConfig(track="sequence", num_steps=40, temperature=0.6)
+)
+```
+
+## Performance Optimization
+
+### Memory Management
+
+For large proteins or batch processing:
+
+```python
+import torch
+
+# Clear CUDA cache between generations
+torch.cuda.empty_cache()
+
+# Use half precision for memory efficiency
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda").half()
+
+# Process in chunks for very long sequences
+def chunk_generate(model, long_sequence, chunk_size=500):
+    chunks = [long_sequence[i:i+chunk_size]
+              for i in range(0, len(long_sequence), chunk_size)]
+    results = []
+
+    for chunk in chunks:
+        protein = ESMProtein(sequence=chunk)
+        result = model.generate(protein, GenerationConfig(track="sequence"))
+        results.append(result.sequence)
+
+    return ''.join(results)
+```
+
+### Batch Processing Tips
+
+When processing multiple proteins:
+
+1. Sort by sequence length for efficient batching
+2. Use padding for similar-length sequences
+3. Process on GPU when available
+4. Implement checkpointing for long-running jobs
+5. Use Forge API for large-scale processing (see `forge-api.md`)
+
+## Error Handling
+
+```python
+try:
+    protein = model.generate(protein_input, config)
+except ValueError as e:
+    print(f"Invalid input: {e}")
+    # Handle invalid sequence or structure
+except RuntimeError as e:
+    print(f"Generation failed: {e}")
+    # Handle model errors
+except torch.cuda.OutOfMemoryError:
+    print("GPU out of memory - try smaller model or CPU")
+    # Fallback to CPU or smaller model
+```
+
+## Model-Specific Considerations
+
+**esm3-sm-open-v1:**
+- Suitable for development and testing
+- Lower quality than larger models
+- Fast inference on consumer GPUs
+- Open weights allow fine-tuning
+
+**esm3-medium-2024-08:**
+- Production quality
+- Good balance of speed and accuracy
+- Requires Forge API access
+- Recommended for most applications
+
+**esm3-large-2024-03:**
+- State-of-the-art quality
+- Slowest inference
+- Use for critical applications
+- Best for novel protein design
+
+## Citation
+
+If using ESM3 in research, cite:
+
+```
+Hayes, T. et al. (2025). Simulating 500 million years of evolution with a language model.
+Science. DOI: 10.1126/science.ads0018
+```

skills/esm/references/forge-api.md

@@ -0,0 +1,657 @@
+# Forge API Reference
+
+## Overview
+
+Forge is EvolutionaryScale's cloud platform for scalable protein design and inference. It provides API access to the full ESM3 model family, including large models not available for local execution.
+
+**Key Benefits:**
+- Access to all ESM3 models including 98B parameter version
+- No local GPU requirements
+- Scalable batch processing
+- Automatic updates to latest models
+- Production-ready infrastructure
+- Async/concurrent request support
+
+## Getting Started
+
+### 1. Obtain API Token
+
+Sign up and get your API token at: https://forge.evolutionaryscale.ai
+
+### 2. Install ESM SDK
+
+```bash
+pip install esm
+```
+
+The Forge client is included in the standard ESM package.
+
+### 3. Basic Connection
+
+```python
+from esm.sdk.forge import ESM3ForgeInferenceClient
+from esm.sdk.api import ESMProtein, GenerationConfig
+
+# Initialize client
+client = ESM3ForgeInferenceClient(
+    model="esm3-medium-2024-08",
+    url="https://forge.evolutionaryscale.ai",
+    token="<your-token-here>"
+)
+
+# Test connection
+protein = ESMProtein(sequence="MPRT___KEND")
+result = client.generate(protein, GenerationConfig(track="sequence", num_steps=8))
+print(result.sequence)
+```
+
+## Available Models
+
+| Model ID | Parameters | Speed | Quality | Use Case |
+|----------|-----------|-------|---------|----------|
+| `esm3-small-2024-08` | 1.4B | Fastest | Good | Rapid prototyping, testing |
+| `esm3-medium-2024-08` | 7B | Fast | Excellent | Production, most applications |
+| `esm3-large-2024-03` | 98B | Slower | Best | Research, critical designs |
+| `esm3-medium-multimer-2024-09` | 7B | Fast | Experimental | Protein complexes |
+
+**Model Selection Guidelines:**
+
+- **Development/Testing**: Use `esm3-small-2024-08` for quick iteration
+- **Production**: Use `esm3-medium-2024-08` for best balance
+- **Research/Critical**: Use `esm3-large-2024-03` for highest quality
+- **Complexes**: Use `esm3-medium-multimer-2024-09` (experimental)
+
+## ESM3ForgeInferenceClient API
+
+### Initialization
+
+```python
+from esm.sdk.forge import ESM3ForgeInferenceClient
+
+# Basic initialization
+client = ESM3ForgeInferenceClient(
+    model="esm3-medium-2024-08",
+    token="<your-token>"
+)
+
+# With custom URL (for enterprise deployments)
+client = ESM3ForgeInferenceClient(
+    model="esm3-medium-2024-08",
+    url="https://custom.forge.instance.com",
+    token="<your-token>"
+)
+
+# With timeout configuration
+client = ESM3ForgeInferenceClient(
+    model="esm3-medium-2024-08",
+    token="<your-token>",
+    timeout=300  # 5 minutes
+)
+```
+
+### Synchronous Generation
+
+Standard blocking generation calls:
+
+```python
+from esm.sdk.api import ESMProtein, GenerationConfig
+
+# Basic generation
+protein = ESMProtein(sequence="MPRT___KEND")
+config = GenerationConfig(track="sequence", num_steps=8)
+
+result = client.generate(protein, config)
+print(f"Generated: {result.sequence}")
+```
+
+### Asynchronous Generation
+
+For concurrent processing of multiple proteins:
+
+```python
+import asyncio
+from esm.sdk.api import ESMProtein, GenerationConfig
+
+async def generate_many(client, proteins):
+    """Generate multiple proteins concurrently."""
+    tasks = []
+
+    for protein in proteins:
+        task = client.async_generate(
+            protein,
+            GenerationConfig(track="sequence", num_steps=8)
+        )
+        tasks.append(task)
+
+    results = await asyncio.gather(*tasks)
+    return results
+
+# Usage
+proteins = [
+    ESMProtein(sequence=f"MPRT{'_' * 10}KEND"),
+    ESMProtein(sequence=f"AGLV{'_' * 10}HSPQ"),
+    ESMProtein(sequence=f"KEIT{'_' * 10}NDFL")
+]
+
+results = asyncio.run(generate_many(client, proteins))
+print(f"Generated {len(results)} proteins")
+```
+
+### Batch Processing with BatchExecutor
+
+For large-scale processing with automatic concurrency management:
+
+```python
+from esm.sdk.forge import BatchExecutor
+from esm.sdk.api import ESMProtein, GenerationConfig
+
+# Create batch executor
+executor = BatchExecutor(
+    client=client,
+    max_concurrent=10  # Process 10 requests concurrently
+)
+
+# Prepare batch of proteins
+proteins = [ESMProtein(sequence=f"MPRT{'_' * 50}KEND") for _ in range(100)]
+config = GenerationConfig(track="sequence", num_steps=25)
+
+# Submit batch
+batch_results = executor.submit_batch(
+    proteins=proteins,
+    config=config,
+    progress_callback=lambda i, total: print(f"Processed {i}/{total}")
+)
+
+print(f"Completed {len(batch_results)} generations")
+```
+
+## Rate Limiting and Quotas
+
+### Understanding Limits
+
+Forge implements rate limiting based on:
+- Requests per minute (RPM)
+- Tokens per minute (TPM)
+- Concurrent requests
+
+**Typical Limits (subject to change):**
+- Free tier: 60 RPM, 5 concurrent
+- Pro tier: 300 RPM, 20 concurrent
+- Enterprise: Custom limits
+
+### Handling Rate Limits
+
+```python
+import time
+from requests.exceptions import HTTPError
+
+def generate_with_retry(client, protein, config, max_retries=3):
+    """Generate with automatic retry on rate limit."""
+    for attempt in range(max_retries):
+        try:
+            return client.generate(protein, config)
+        except HTTPError as e:
+            if e.response.status_code == 429:  # Rate limit
+                wait_time = 2 ** attempt  # Exponential backoff
+                print(f"Rate limited, waiting {wait_time}s...")
+                time.sleep(wait_time)
+            else:
+                raise
+    raise Exception("Max retries exceeded")
+
+# Usage
+result = generate_with_retry(client, protein, config)
+```
+
+### Implementing Custom Rate Limiter
+
+```python
+import time
+from collections import deque
+
+class RateLimiter:
+    """Simple rate limiter for API calls."""
+
+    def __init__(self, max_per_minute=60):
+        self.max_per_minute = max_per_minute
+        self.calls = deque()
+
+    def wait_if_needed(self):
+        """Wait if rate limit would be exceeded."""
+        now = time.time()
+
+        # Remove old calls
+        while self.calls and self.calls[0] < now - 60:
+            self.calls.popleft()
+
+        # Wait if at limit
+        if len(self.calls) >= self.max_per_minute:
+            sleep_time = 60 - (now - self.calls[0])
+            if sleep_time > 0:
+                time.sleep(sleep_time)
+            self.calls.popleft()
+
+        self.calls.append(now)
+
+# Usage
+limiter = RateLimiter(max_per_minute=60)
+
+for protein in proteins:
+    limiter.wait_if_needed()
+    result = client.generate(protein, config)
+```
+
+## Advanced Patterns
+
+### Streaming Results
+
+Process results as they complete:
+
+```python
+import asyncio
+from concurrent.futures import ThreadPoolExecutor
+
+async def stream_generate(client, proteins, config):
+    """Stream results as they complete."""
+    pending = {
+        asyncio.create_task(client.async_generate(p, config)): i
+        for i, p in enumerate(proteins)
+    }
+
+    results = [None] * len(proteins)
+
+    while pending:
+        done, pending = await asyncio.wait(
+            pending.keys(),
+            return_when=asyncio.FIRST_COMPLETED
+        )
+
+        for task in done:
+            idx = pending.pop(task)
+            result = await task
+            results[idx] = result
+            yield idx, result
+
+# Usage
+async def process_stream():
+    async for idx, result in stream_generate(client, proteins, config):
+        print(f"Completed protein {idx}: {result.sequence[:20]}...")
+
+asyncio.run(process_stream())
+```
+
+### Batch with Progress Tracking
+
+```python
+from tqdm import tqdm
+import asyncio
+
+async def batch_with_progress(client, proteins, config):
+    """Process batch with progress bar."""
+    results = []
+
+    with tqdm(total=len(proteins)) as pbar:
+        for protein in proteins:
+            result = await client.async_generate(protein, config)
+            results.append(result)
+            pbar.update(1)
+
+    return results
+
+# Usage
+results = asyncio.run(batch_with_progress(client, proteins, config))
+```
+
+### Checkpoint and Resume
+
+For long-running batch jobs:
+
+```python
+import pickle
+import os
+
+class CheckpointedBatchProcessor:
+    """Batch processor with checkpoint/resume capability."""
+
+    def __init__(self, client, checkpoint_file="checkpoint.pkl"):
+        self.client = client
+        self.checkpoint_file = checkpoint_file
+        self.completed = self.load_checkpoint()
+
+    def load_checkpoint(self):
+        if os.path.exists(self.checkpoint_file):
+            with open(self.checkpoint_file, 'rb') as f:
+                return pickle.load(f)
+        return {}
+
+    def save_checkpoint(self):
+        with open(self.checkpoint_file, 'wb') as f:
+            pickle.dump(self.completed, f)
+
+    def process_batch(self, proteins, config):
+        """Process batch with checkpointing."""
+        results = {}
+
+        for i, protein in enumerate(proteins):
+            # Skip if already completed
+            if i in self.completed:
+                results[i] = self.completed[i]
+                continue
+
+            try:
+                result = self.client.generate(protein, config)
+                results[i] = result
+                self.completed[i] = result
+
+                # Save checkpoint every 10 items
+                if i % 10 == 0:
+                    self.save_checkpoint()
+
+            except Exception as e:
+                print(f"Error processing {i}: {e}")
+                self.save_checkpoint()
+                raise
+
+        self.save_checkpoint()
+        return results
+
+# Usage
+processor = CheckpointedBatchProcessor(client)
+results = processor.process_batch(proteins, config)
+```
+
+## Error Handling
+
+### Common Errors and Solutions
+
+```python
+from requests.exceptions import HTTPError, ConnectionError, Timeout
+
+def robust_generate(client, protein, config):
+    """Generate with comprehensive error handling."""
+    try:
+        return client.generate(protein, config)
+
+    except HTTPError as e:
+        if e.response.status_code == 401:
+            raise ValueError("Invalid API token")
+        elif e.response.status_code == 429:
+            raise ValueError("Rate limit exceeded - slow down requests")
+        elif e.response.status_code == 500:
+            raise ValueError("Server error - try again later")
+        else:
+            raise
+
+    except ConnectionError:
+        raise ValueError("Network error - check internet connection")
+
+    except Timeout:
+        raise ValueError("Request timeout - try smaller protein or increase timeout")
+
+    except Exception as e:
+        raise ValueError(f"Unexpected error: {str(e)}")
+
+# Usage with retry logic
+def generate_with_full_retry(client, protein, config, max_retries=3):
+    """Combine error handling with retry logic."""
+    for attempt in range(max_retries):
+        try:
+            return robust_generate(client, protein, config)
+        except ValueError as e:
+            if "rate limit" in str(e).lower() and attempt < max_retries - 1:
+                time.sleep(2 ** attempt)
+                continue
+            raise
+```
+
+## Cost Optimization
+
+### Strategies to Reduce Costs
+
+**1. Use Appropriate Model Size:**
+
+```python
+# Use smaller model for testing
+dev_client = ESM3ForgeInferenceClient(
+    model="esm3-small-2024-08",
+    token=token
+)
+
+# Use larger model only for final generation
+prod_client = ESM3ForgeInferenceClient(
+    model="esm3-large-2024-03",
+    token=token
+)
+```
+
+**2. Cache Results:**
+
+```python
+import hashlib
+import json
+
+class ForgeCache:
+    """Cache Forge API results locally."""
+
+    def __init__(self, cache_dir="forge_cache"):
+        self.cache_dir = cache_dir
+        os.makedirs(cache_dir, exist_ok=True)
+
+    def get_cache_key(self, protein, config):
+        """Generate cache key from inputs."""
+        data = {
+            'sequence': protein.sequence,
+            'config': str(config)
+        }
+        return hashlib.md5(json.dumps(data, sort_keys=True).encode()).hexdigest()
+
+    def get(self, protein, config):
+        """Get cached result."""
+        key = self.get_cache_key(protein, config)
+        path = os.path.join(self.cache_dir, f"{key}.pkl")
+
+        if os.path.exists(path):
+            with open(path, 'rb') as f:
+                return pickle.load(f)
+        return None
+
+    def set(self, protein, config, result):
+        """Cache result."""
+        key = self.get_cache_key(protein, config)
+        path = os.path.join(self.cache_dir, f"{key}.pkl")
+
+        with open(path, 'wb') as f:
+            pickle.dump(result, f)
+
+# Usage
+cache = ForgeCache()
+
+def cached_generate(client, protein, config):
+    """Generate with caching."""
+    cached = cache.get(protein, config)
+    if cached:
+        return cached
+
+    result = client.generate(protein, config)
+    cache.set(protein, config, result)
+    return result
+```
+
+**3. Batch Similar Requests:**
+
+Group similar generation tasks to reduce overhead:
+
+```python
+def batch_similar_tasks(proteins, max_batch_size=50):
+    """Group proteins by similar properties."""
+    # Sort by length for efficient processing
+    sorted_proteins = sorted(proteins, key=lambda p: len(p.sequence))
+
+    batches = []
+    current_batch = []
+
+    for protein in sorted_proteins:
+        current_batch.append(protein)
+
+        if len(current_batch) >= max_batch_size:
+            batches.append(current_batch)
+            current_batch = []
+
+    if current_batch:
+        batches.append(current_batch)
+
+    return batches
+```
+
+## Monitoring and Logging
+
+### Track API Usage
+
+```python
+import logging
+from datetime import datetime
+
+class ForgeMonitor:
+    """Monitor Forge API usage."""
+
+    def __init__(self):
+        self.calls = []
+        self.errors = []
+
+    def log_call(self, model, protein_length, duration, success=True, error=None):
+        """Log API call."""
+        entry = {
+            'timestamp': datetime.now(),
+            'model': model,
+            'protein_length': protein_length,
+            'duration': duration,
+            'success': success,
+            'error': str(error) if error else None
+        }
+
+        if success:
+            self.calls.append(entry)
+        else:
+            self.errors.append(entry)
+
+    def get_stats(self):
+        """Get usage statistics."""
+        total_calls = len(self.calls) + len(self.errors)
+        success_rate = len(self.calls) / total_calls if total_calls > 0 else 0
+        avg_duration = sum(c['duration'] for c in self.calls) / len(self.calls) if self.calls else 0
+
+        return {
+            'total_calls': total_calls,
+            'successful': len(self.calls),
+            'failed': len(self.errors),
+            'success_rate': success_rate,
+            'avg_duration': avg_duration
+        }
+
+# Usage
+monitor = ForgeMonitor()
+
+def monitored_generate(client, protein, config):
+    """Generate with monitoring."""
+    start = time.time()
+
+    try:
+        result = client.generate(protein, config)
+        duration = time.time() - start
+        monitor.log_call(
+            model=client.model,
+            protein_length=len(protein.sequence),
+            duration=duration,
+            success=True
+        )
+        return result
+
+    except Exception as e:
+        duration = time.time() - start
+        monitor.log_call(
+            model=client.model,
+            protein_length=len(protein.sequence),
+            duration=duration,
+            success=False,
+            error=e
+        )
+        raise
+
+# Check stats
+print(monitor.get_stats())
+```
+
+## AWS SageMaker Deployment
+
+For dedicated infrastructure and enterprise use:
+
+### Deployment Options
+
+1. **AWS Marketplace Listing**: Deploy ESM3 via AWS SageMaker Marketplace
+2. **Custom Endpoint**: Configure dedicated inference endpoint
+3. **Batch Transform**: Use SageMaker Batch Transform for large-scale processing
+
+### Benefits
+
+- Dedicated compute resources
+- No rate limiting beyond your infrastructure
+- Data stays in your AWS environment
+- Integration with AWS services
+- Custom instance types and scaling
+
+**More Information:**
+- AWS Marketplace: https://aws.amazon.com/marketplace/seller-profile?id=seller-iw2nbscescndm
+- Contact EvolutionaryScale for enterprise licensing
+
+## Best Practices Summary
+
+1. **Authentication**: Store tokens securely (environment variables, secrets manager)
+2. **Rate Limiting**: Implement exponential backoff and respect limits
+3. **Error Handling**: Always handle network errors and retries
+4. **Caching**: Cache results for repeated queries
+5. **Model Selection**: Use appropriate model size for task
+6. **Batch Processing**: Use async/batch processing for multiple proteins
+7. **Monitoring**: Track usage and costs
+8. **Checkpointing**: Save progress for long-running jobs
+
+## Troubleshooting
+
+### Connection Issues
+
+```python
+# Test connection
+try:
+    client = ESM3ForgeInferenceClient(model="esm3-medium-2024-08", token=token)
+    test_protein = ESMProtein(sequence="MPRTK")
+    result = client.generate(test_protein, GenerationConfig(track="sequence", num_steps=1))
+    print("Connection successful!")
+except Exception as e:
+    print(f"Connection failed: {e}")
+```
+
+### Token Validation
+
+```python
+def validate_token(token):
+    """Validate API token."""
+    try:
+        client = ESM3ForgeInferenceClient(
+            model="esm3-small-2024-08",
+            token=token
+        )
+        # Make minimal test call
+        test = ESMProtein(sequence="MPR")
+        client.generate(test, GenerationConfig(track="sequence", num_steps=1))
+        return True
+    except HTTPError as e:
+        if e.response.status_code == 401:
+            return False
+        raise
+```
+
+## Additional Resources
+
+- **Forge Platform**: https://forge.evolutionaryscale.ai
+- **API Documentation**: Check Forge dashboard for latest API specs
+- **Community Support**: Slack community at https://bit.ly/3FKwcWd
+- **Enterprise Contact**: Contact EvolutionaryScale for custom deployments

skills/esm/references/workflows.md

@@ -0,0 +1,685 @@
+# ESM Workflows and Examples
+
+## Overview
+
+This document provides complete, end-to-end examples of common workflows using ESM3 and ESM C. Each workflow includes setup, execution, and analysis code.
+
+## Workflow 1: Novel GFP Design with Chain-of-Thought
+
+Design a novel fluorescent protein using ESM3's multimodal generation capabilities.
+
+### Objective
+
+Generate a green fluorescent protein (GFP) with specific properties using chain-of-thought reasoning across sequence, structure, and function.
+
+### Complete Implementation
+
+```python
+from esm.models.esm3 import ESM3
+from esm.sdk.api import ESMProtein, GenerationConfig, FunctionAnnotation
+import matplotlib.pyplot as plt
+
+# Setup
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+
+# Step 1: Define target properties
+print("Step 1: Defining target GFP properties...")
+
+# Create protein with desired function
+target_length = 238  # Typical GFP length
+protein = ESMProtein(
+    sequence="_" * target_length,
+    function_annotations=[
+        FunctionAnnotation(
+            label="green_fluorescent_protein",
+            start=65,
+            end=75  # Chromophore region
+        )
+    ]
+)
+
+# Step 2: Generate initial sequence with function conditioning
+print("Step 2: Generating initial sequence...")
+
+config = GenerationConfig(
+    track="sequence",
+    num_steps=target_length // 3,  # Gradual generation
+    temperature=0.7  # Moderate diversity
+)
+protein = model.generate(protein, config)
+print(f"Generated sequence: {protein.sequence[:50]}...")
+
+# Step 3: Predict structure
+print("Step 3: Predicting structure...")
+
+config = GenerationConfig(
+    track="structure",
+    num_steps=target_length // 2
+)
+protein = model.generate(protein, config)
+print(f"Structure predicted, coordinates shape: {protein.coordinates.shape}")
+
+# Step 4: Refine sequence based on structure
+print("Step 4: Refining sequence based on structure...")
+
+# Mask regions for refinement (e.g., surface residues)
+sequence_list = list(protein.sequence)
+# Keep chromophore region, refine others
+for i in range(0, 65):
+    if i % 3 == 0:  # Refine every third position
+        sequence_list[i] = '_'
+for i in range(75, target_length):
+    if i % 3 == 0:
+        sequence_list[i] = '_'
+
+protein.sequence = ''.join(sequence_list)
+
+config = GenerationConfig(
+    track="sequence",
+    num_steps=50,
+    temperature=0.5  # Lower temperature for refinement
+)
+protein = model.generate(protein, config)
+
+# Step 5: Final validation
+print("Step 5: Final validation...")
+
+# Predict final structure
+config = GenerationConfig(track="structure", num_steps=30)
+protein = model.generate(protein, config)
+
+# Save results
+with open("novel_gfp.pdb", "w") as f:
+    f.write(protein.to_pdb())
+
+with open("novel_gfp_sequence.txt", "w") as f:
+    f.write(f">Novel_GFP\n{protein.sequence}\n")
+
+print(f"\nFinal GFP sequence:\n{protein.sequence}")
+print(f"\nFunction annotations: {protein.function_annotations}")
+print(f"Structure saved to: novel_gfp.pdb")
+```
+
+### Validation Steps
+
+```python
+# Analyze designed GFP
+def analyze_gfp(protein):
+    """Analyze generated GFP properties."""
+
+    # Check chromophore region (should be around Ser65-Tyr66-Gly67)
+    chromophore_region = protein.sequence[64:68]
+    print(f"Chromophore region: {chromophore_region}")
+
+    # Check barrel structure (GFPs have beta-barrel)
+    # Analyze secondary structure if available
+    if protein.secondary_structure:
+        beta_content = protein.secondary_structure.count('E') / len(protein.sequence)
+        print(f"Beta sheet content: {beta_content:.2%}")
+
+    # Check sequence similarity to known GFPs
+    # (Would require BLAST or alignment tool in practice)
+
+    return {
+        'length': len(protein.sequence),
+        'chromophore': chromophore_region,
+        'coordinates_available': protein.coordinates is not None
+    }
+
+analysis = analyze_gfp(protein)
+print(f"\nAnalysis results: {analysis}")
+```
+
+## Workflow 2: Protein Variant Library Generation
+
+Generate and analyze a library of protein variants for directed evolution.
+
+### Objective
+
+Create variants of a parent protein by targeted mutagenesis while maintaining structural integrity.
+
+### Complete Implementation
+
+```python
+from esm.models.esm3 import ESM3
+from esm.sdk.api import ESMProtein, GenerationConfig
+import numpy as np
+from sklearn.cluster import KMeans
+
+# Setup
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+
+# Parent protein
+parent_sequence = "MPRTKEINDAGLIVHSPQWFYKARNDTESLGKIVHEFPM"
+parent_protein = ESMProtein(sequence=parent_sequence)
+
+# Define mutation parameters
+num_variants = 50
+positions_to_mutate = 5  # Number of positions per variant
+
+# Step 1: Generate variant library
+print("Generating variant library...")
+
+variants = []
+for i in range(num_variants):
+    # Create masked sequence with random positions
+    seq_list = list(parent_sequence)
+
+    # Select random positions to mutate
+    mutation_positions = np.random.choice(
+        len(seq_list),
+        size=positions_to_mutate,
+        replace=False
+    )
+
+    for pos in mutation_positions:
+        seq_list[pos] = '_'
+
+    # Generate variant
+    variant_protein = ESMProtein(sequence=''.join(seq_list))
+
+    config = GenerationConfig(
+        track="sequence",
+        num_steps=positions_to_mutate * 2,
+        temperature=0.8  # Higher diversity
+    )
+
+    variant = model.generate(variant_protein, config)
+    variants.append(variant.sequence)
+
+    if (i + 1) % 10 == 0:
+        print(f"Generated {i + 1}/{num_variants} variants")
+
+print(f"\nGenerated {len(variants)} variants")
+
+# Step 2: Predict structures for variants
+print("\nPredicting structures...")
+
+variant_proteins_with_structure = []
+for i, seq in enumerate(variants):
+    protein = ESMProtein(sequence=seq)
+
+    config = GenerationConfig(
+        track="structure",
+        num_steps=len(seq) // 2
+    )
+
+    protein_with_structure = model.generate(protein, config)
+    variant_proteins_with_structure.append(protein_with_structure)
+
+    if (i + 1) % 10 == 0:
+        print(f"Predicted structures for {i + 1}/{len(variants)} variants")
+
+# Step 3: Analyze variant diversity
+print("\nAnalyzing variant diversity...")
+
+# Calculate Hamming distances from parent
+def hamming_distance(seq1, seq2):
+    """Calculate Hamming distance between sequences."""
+    return sum(c1 != c2 for c1, c2 in zip(seq1, seq2))
+
+distances = [hamming_distance(parent_sequence, var) for var in variants]
+print(f"Average mutations per variant: {np.mean(distances):.1f}")
+print(f"Mutation range: {min(distances)}-{max(distances)}")
+
+# Step 4: Get embeddings for clustering
+print("\nGenerating embeddings for clustering...")
+
+from esm.models.esmc import ESMC
+
+embedding_model = ESMC.from_pretrained("esmc-300m").to("cuda")
+
+def get_embedding(sequence):
+    """Get mean-pooled embedding for sequence."""
+    protein = ESMProtein(sequence=sequence)
+    tensor = embedding_model.encode(protein)
+    emb = embedding_model.forward(tensor)
+    return emb.mean(dim=1).cpu().detach().numpy().flatten()
+
+variant_embeddings = np.array([get_embedding(seq) for seq in variants])
+
+# Step 5: Cluster variants
+print("Clustering variants...")
+
+n_clusters = 5
+kmeans = KMeans(n_clusters=n_clusters, random_state=42)
+cluster_labels = kmeans.fit_predict(variant_embeddings)
+
+# Analyze clusters
+print("\nCluster analysis:")
+for i in range(n_clusters):
+    cluster_variants = [var for var, label in zip(variants, cluster_labels) if label == i]
+    cluster_distances = [hamming_distance(parent_sequence, var) for var in cluster_variants]
+
+    print(f"\nCluster {i}:")
+    print(f"  Size: {len(cluster_variants)}")
+    print(f"  Avg distance from parent: {np.mean(cluster_distances):.1f}")
+    print(f"  Representative: {cluster_variants[0][:40]}...")
+
+# Step 6: Select diverse representatives
+print("\nSelecting diverse representatives...")
+
+representatives = []
+for i in range(n_clusters):
+    # Get centroid
+    cluster_indices = np.where(cluster_labels == i)[0]
+    cluster_embs = variant_embeddings[cluster_indices]
+
+    # Find closest to centroid
+    centroid = cluster_embs.mean(axis=0)
+    distances_to_centroid = np.linalg.norm(cluster_embs - centroid, axis=1)
+    rep_idx = cluster_indices[np.argmin(distances_to_centroid)]
+
+    representatives.append(variants[rep_idx])
+
+# Save results
+print("\nSaving results...")
+
+with open("variant_library.fasta", "w") as f:
+    f.write(f">Parent\n{parent_sequence}\n\n")
+    for i, var in enumerate(variants):
+        f.write(f">Variant_{i+1}_Cluster_{cluster_labels[i]}\n{var}\n")
+
+with open("representative_variants.fasta", "w") as f:
+    for i, rep in enumerate(representatives):
+        f.write(f">Representative_Cluster_{i}\n{rep}\n")
+
+print("Variant library saved to: variant_library.fasta")
+print("Representatives saved to: representative_variants.fasta")
+```
+
+## Workflow 3: Structure-Based Sequence Optimization
+
+Optimize a protein sequence to improve stability while maintaining function.
+
+### Objective
+
+Given a protein structure, design sequences that maintain the fold but have improved properties.
+
+### Complete Implementation
+
+```python
+from esm.models.esm3 import ESM3
+from esm.sdk.api import ESMProtein, GenerationConfig
+import numpy as np
+
+# Setup
+model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+
+# Load target structure (e.g., from PDB)
+target_protein = ESMProtein.from_pdb("target_structure.pdb")
+original_sequence = target_protein.sequence
+
+print(f"Original sequence: {original_sequence}")
+print(f"Structure loaded: {target_protein.coordinates.shape}")
+
+# Step 1: Generate multiple sequence designs
+print("\nGenerating optimized sequences...")
+
+num_designs = 20
+optimized_sequences = []
+
+for i in range(num_designs):
+    # Start with structure, remove sequence
+    design_protein = ESMProtein(
+        coordinates=target_protein.coordinates.copy(),
+        secondary_structure=target_protein.secondary_structure
+    )
+
+    # Generate sequence for this structure
+    config = GenerationConfig(
+        track="sequence",
+        num_steps=len(original_sequence),
+        temperature=0.7,
+        condition_on_coordinates_only=True
+    )
+
+    designed = model.generate(design_protein, config)
+    optimized_sequences.append(designed.sequence)
+
+    if (i + 1) % 5 == 0:
+        print(f"Generated {i + 1}/{num_designs} designs")
+
+# Step 2: Validate structural compatibility
+print("\nValidating structural compatibility...")
+
+validated_designs = []
+
+for seq in optimized_sequences:
+    # Predict structure for designed sequence
+    test_protein = ESMProtein(sequence=seq)
+
+    config = GenerationConfig(
+        track="structure",
+        num_steps=len(seq) // 2
+    )
+
+    predicted = model.generate(test_protein, config)
+
+    # Calculate RMSD (simplified - in practice use proper alignment)
+    # Here we just check if structure prediction succeeds
+    if predicted.coordinates is not None:
+        validated_designs.append(seq)
+
+print(f"Validated {len(validated_designs)}/{num_designs} designs")
+
+# Step 3: Analyze sequence properties
+print("\nAnalyzing sequence properties...")
+
+def calculate_properties(sequence):
+    """Calculate basic sequence properties."""
+    # Hydrophobicity (simplified)
+    hydrophobic = "AILMFWYV"
+    hydrophobic_fraction = sum(1 for aa in sequence if aa in hydrophobic) / len(sequence)
+
+    # Charge
+    positive = "KR"
+    negative = "DE"
+    net_charge = sum(1 for aa in sequence if aa in positive) - sum(1 for aa in sequence if aa in negative)
+
+    # Aromatic content
+    aromatic = "FWY"
+    aromatic_fraction = sum(1 for aa in sequence if aa in aromatic) / len(sequence)
+
+    return {
+        'hydrophobic_fraction': hydrophobic_fraction,
+        'net_charge': net_charge,
+        'aromatic_fraction': aromatic_fraction
+    }
+
+# Compare to original
+original_props = calculate_properties(original_sequence)
+print(f"\nOriginal properties:")
+print(f"  Hydrophobic: {original_props['hydrophobic_fraction']:.2%}")
+print(f"  Net charge: {original_props['net_charge']:+d}")
+print(f"  Aromatic: {original_props['aromatic_fraction']:.2%}")
+
+# Analyze designs
+design_properties = [calculate_properties(seq) for seq in validated_designs]
+
+avg_hydrophobic = np.mean([p['hydrophobic_fraction'] for p in design_properties])
+avg_charge = np.mean([p['net_charge'] for p in design_properties])
+avg_aromatic = np.mean([p['aromatic_fraction'] for p in design_properties])
+
+print(f"\nDesigned sequences (average):")
+print(f"  Hydrophobic: {avg_hydrophobic:.2%}")
+print(f"  Net charge: {avg_charge:+.1f}")
+print(f"  Aromatic: {avg_aromatic:.2%}")
+
+# Step 4: Rank designs
+print("\nRanking designs...")
+
+def score_design(sequence, original_props):
+    """Score design based on desired properties."""
+    props = calculate_properties(sequence)
+
+    # Prefer higher hydrophobic content (for stability)
+    hydrophobic_score = props['hydrophobic_fraction']
+
+    # Prefer similar charge to original
+    charge_score = 1.0 / (1.0 + abs(props['net_charge'] - original_props['net_charge']))
+
+    # Combined score
+    return hydrophobic_score * 0.6 + charge_score * 0.4
+
+scores = [(seq, score_design(seq, original_props)) for seq in validated_designs]
+scores.sort(key=lambda x: x[1], reverse=True)
+
+print("\nTop 5 designs:")
+for i, (seq, score) in enumerate(scores[:5]):
+    print(f"\n{i+1}. Score: {score:.3f}")
+    print(f"   Sequence: {seq[:40]}...")
+
+# Step 5: Save results
+print("\nSaving results...")
+
+with open("optimized_sequences.fasta", "w") as f:
+    f.write(f">Original\n{original_sequence}\n\n")
+
+    for i, (seq, score) in enumerate(scores):
+        props = calculate_properties(seq)
+        f.write(f">Design_{i+1}_Score_{score:.3f}\n")
+        f.write(f"# Hydrophobic: {props['hydrophobic_fraction']:.2%}, ")
+        f.write(f"Charge: {props['net_charge']:+d}, ")
+        f.write(f"Aromatic: {props['aromatic_fraction']:.2%}\n")
+        f.write(f"{seq}\n\n")
+
+print("Results saved to: optimized_sequences.fasta")
+```
+
+## Workflow 4: Function Prediction Pipeline
+
+Predict protein function from sequence using ESM3 and ESM C.
+
+### Objective
+
+Build a pipeline that predicts protein function using both generative (ESM3) and embedding (ESM C) approaches.
+
+### Complete Implementation
+
+```python
+from esm.models.esm3 import ESM3
+from esm.models.esmc import ESMC
+from esm.sdk.api import ESMProtein, GenerationConfig
+import numpy as np
+from sklearn.ensemble import RandomForestClassifier
+from sklearn.model_selection import cross_val_score
+
+# Setup models
+esm3_model = ESM3.from_pretrained("esm3-sm-open-v1").to("cuda")
+esmc_model = ESMC.from_pretrained("esmc-600m").to("cuda")
+
+# Example: Predict if protein is an enzyme
+# (In practice, you'd have a labeled training set)
+
+def predict_function_generative(sequence):
+    """Predict function using ESM3 generative approach."""
+
+    protein = ESMProtein(sequence=sequence)
+
+    # Generate function annotations
+    config = GenerationConfig(
+        track="function",
+        num_steps=20,
+        temperature=0.3  # Low temperature for confident predictions
+    )
+
+    protein_with_function = esm3_model.generate(protein, config)
+
+    return protein_with_function.function_annotations
+
+def predict_function_embedding(sequence, function_classifier):
+    """Predict function using ESM C embeddings + classifier."""
+
+    # Get embedding
+    protein = ESMProtein(sequence=sequence)
+    tensor = esmc_model.encode(protein)
+    embedding = esmc_model.forward(tensor)
+
+    # Mean pool
+    embedding_pooled = embedding.mean(dim=1).cpu().detach().numpy()
+
+    # Predict with classifier
+    prediction = function_classifier.predict(embedding_pooled)
+    probability = function_classifier.predict_proba(embedding_pooled)
+
+    return prediction[0], probability[0]
+
+# Example workflow with test sequences
+test_sequences = {
+    "kinase": "MPRTKEINDAGLIVHSPQWFYKARNDTESLGKIVHEF",
+    "protease": "AGLIVHSPQWFYKARNDTESLGKIVHEFPMCDEGH",
+    "transporter": "KTEFLNDGRPMLIVHSPQWFYKARNDTESLGKIVH"
+}
+
+print("Predicting functions...\n")
+
+for name, sequence in test_sequences.items():
+    print(f"{name.upper()}:")
+    print(f"Sequence: {sequence[:30]}...")
+
+    # Method 1: Generative
+    functions = predict_function_generative(sequence)
+    print(f"  Generative predictions: {functions}")
+
+    # Method 2: Embedding-based would require trained classifier
+    # (Skipped in this example as it needs training data)
+
+    print()
+```
+
+## Workflow 5: Embedding-Based Clustering and Analysis
+
+Cluster and analyze a large protein dataset using ESM C embeddings.
+
+### Complete Implementation
+
+```python
+from esm.models.esmc import ESMC
+from esm.sdk.api import ESMProtein
+import numpy as np
+from sklearn.cluster import DBSCAN
+from sklearn.decomposition import PCA
+from sklearn.manifold import TSNE
+import matplotlib.pyplot as plt
+
+# Setup
+model = ESMC.from_pretrained("esmc-600m").to("cuda")
+
+# Load protein dataset (example)
+sequences = [
+    # In practice, load from FASTA or database
+    "MPRTKEINDAGLIVHSPQWFYK",
+    "AGLIVHSPQWFYKARNDTESL",
+    # ... more sequences
+]
+
+print(f"Loaded {len(sequences)} sequences")
+
+# Step 1: Generate embeddings
+print("Generating embeddings...")
+
+embeddings = []
+for i, seq in enumerate(sequences):
+    protein = ESMProtein(sequence=seq)
+    tensor = model.encode(protein)
+    emb = model.forward(tensor)
+
+    # Mean pooling
+    emb_pooled = emb.mean(dim=1).cpu().detach().numpy().flatten()
+    embeddings.append(emb_pooled)
+
+    if (i + 1) % 100 == 0:
+        print(f"Processed {i + 1}/{len(sequences)}")
+
+embeddings = np.array(embeddings)
+print(f"Embeddings shape: {embeddings.shape}")
+
+# Step 2: Dimensionality reduction for visualization
+print("\nReducing dimensionality...")
+
+# PCA for initial reduction
+pca = PCA(n_components=50)
+embeddings_pca = pca.fit_transform(embeddings)
+print(f"PCA explained variance: {pca.explained_variance_ratio_[:10].sum():.2%}")
+
+# t-SNE for visualization
+tsne = TSNE(n_components=2, random_state=42)
+embeddings_2d = tsne.fit_transform(embeddings_pca)
+
+# Step 3: Clustering
+print("\nClustering...")
+
+# DBSCAN for density-based clustering
+clustering = DBSCAN(eps=0.5, min_samples=5)
+cluster_labels = clustering.fit_predict(embeddings)
+
+n_clusters = len(set(cluster_labels)) - (1 if -1 in cluster_labels else 0)
+n_noise = list(cluster_labels).count(-1)
+
+print(f"Number of clusters: {n_clusters}")
+print(f"Number of noise points: {n_noise}")
+
+# Step 4: Visualize
+print("\nGenerating visualization...")
+
+plt.figure(figsize=(12, 8))
+scatter = plt.scatter(
+    embeddings_2d[:, 0],
+    embeddings_2d[:, 1],
+    c=cluster_labels,
+    cmap='viridis',
+    alpha=0.6
+)
+plt.colorbar(scatter)
+plt.title("Protein Sequence Clustering (ESM C Embeddings)")
+plt.xlabel("t-SNE 1")
+plt.ylabel("t-SNE 2")
+plt.savefig("protein_clusters.png", dpi=300, bbox_inches='tight')
+print("Visualization saved to: protein_clusters.png")
+
+# Step 5: Analyze clusters
+print("\nCluster analysis:")
+
+for cluster_id in range(n_clusters):
+    cluster_indices = np.where(cluster_labels == cluster_id)[0]
+    cluster_seqs = [sequences[i] for i in cluster_indices]
+
+    print(f"\nCluster {cluster_id}:")
+    print(f"  Size: {len(cluster_seqs)}")
+    print(f"  Avg length: {np.mean([len(s) for s in cluster_seqs]):.1f}")
+    print(f"  Example: {cluster_seqs[0][:40]}...")
+
+# Save cluster assignments
+with open("cluster_assignments.txt", "w") as f:
+    for i, (seq, label) in enumerate(zip(sequences, cluster_labels)):
+        f.write(f"Sequence_{i}\tCluster_{label}\t{seq}\n")
+
+print("\nCluster assignments saved to: cluster_assignments.txt")
+```
+
+## Additional Workflow Tips
+
+### Memory Management for Large Datasets
+
+```python
+def process_large_dataset(sequences, batch_size=32):
+    """Process large dataset with memory management."""
+    import gc
+    import torch
+
+    results = []
+
+    for i in range(0, len(sequences), batch_size):
+        batch = sequences[i:i + batch_size]
+
+        # Process batch
+        batch_results = [process_sequence(seq) for seq in batch]
+        results.extend(batch_results)
+
+        # Clear memory
+        torch.cuda.empty_cache()
+        gc.collect()
+
+        if (i + batch_size) % 100 == 0:
+            print(f"Processed {min(i + batch_size, len(sequences))}/{len(sequences)}")
+
+    return results
+```
+
+### Parallel Processing
+
+```python
+from concurrent.futures import ThreadPoolExecutor
+import asyncio
+
+def parallel_workflow(sequences, n_workers=4):
+    """Process sequences in parallel."""
+
+    with ThreadPoolExecutor(max_workers=n_workers) as executor:
+        results = list(executor.map(process_sequence, sequences))
+
+    return results
+```
+
+These workflows provide comprehensive examples for common ESM use cases. Adapt them to your specific needs and always validate results with appropriate biological experiments.